CNEP1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNEP1_DROME
• UniProt AC: Q9VRG7
• Protein Name: CTD nuclear envelope phosphatase 1 homolog
• Gene Name: Dd
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 243
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Description: Serine/threonine protein phosphatase that may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol (By similarity)..
• Protein Sequence: MISLLQMKFRALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLHRLW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Phosphorylation	KYELFPLSPVSRHRL EEEEEECCCCCHHHH	24.40	19429919
51	Phosphorylation	LFPLSPVSRHRLSLV EEECCCCCHHHHHHH	26.25	19429919
56	Phosphorylation	PVSRHRLSLVQRKTL CCCHHHHHHHCCCEE	26.84	19429919
115	Phosphorylation	HKRPHVDYFLDVVSQ ECCCCCHHHHHHHHH	12.64	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CNEP1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNEP1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNEP1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERM_DROME	term	physical	14605208
DECA_DROME	dpp	genetic	21790556
MAD_DROME	Mad	genetic	21790556
MAD_DROME	Mad	physical	27578171

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.