UniProt ID | CNEP1_DROME | |
---|---|---|
UniProt AC | Q9VRG7 | |
Protein Name | CTD nuclear envelope phosphatase 1 homolog | |
Gene Name | Dd | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 243 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Serine/threonine protein phosphatase that may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol (By similarity).. | |
Protein Sequence | MISLLQMKFRALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLHRLW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | KYELFPLSPVSRHRL EEEEEECCCCCHHHH | 24.40 | 19429919 | |
51 | Phosphorylation | LFPLSPVSRHRLSLV EEECCCCCHHHHHHH | 26.25 | 19429919 | |
56 | Phosphorylation | PVSRHRLSLVQRKTL CCCHHHHHHHCCCEE | 26.84 | 19429919 | |
115 | Phosphorylation | HKRPHVDYFLDVVSQ ECCCCCHHHHHHHHH | 12.64 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNEP1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNEP1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNEP1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TERM_DROME | term | physical | 14605208 | |
DECA_DROME | dpp | genetic | 21790556 | |
MAD_DROME | Mad | genetic | 21790556 | |
MAD_DROME | Mad | physical | 27578171 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...