| UniProt ID | MEF2_DROME | |
|---|---|---|
| UniProt AC | P40791 | |
| Protein Name | Myocyte-specific enhancer factor 2 | |
| Gene Name | Mef2 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 540 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor that could be a key player in early mesoderm differentiation and may be required for subsequent cell fate specifications within the somatic and visceral/heart mesodermal layers. [PubMed: 7839146] | |
| Protein Sequence | MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLPVSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSGGMSLIIYPSGSMLEMSNGYPHSHSPLVGSPSPGPSPGIAHHLSIKQQSPGSQNGRASNLRVVIPPTIAPIPPNMSAPDDVGYADQRQSQTSLNTPVVTLQTPIPALTSYSFGAQDFSSSGVMNSADIMSLNTWHQGLVPHSSLSHLAVSNSTPPPATSPVSIKVKAEPQSPPRDLSASGHQQNSNGSTGSGGSSSSTSSNASGGAGGGGAVSAANVITHLNNVSVLAGGPSGQGGGGGGGGSNGNVEQATNLSVLSHAQQHHLGMPNSRPSSTGHITPTPGHDKYEGYPYRALMGHNPRWNLNFAGAPSSDQDVRLAAVAVQQQQQQPHQQQQLGDYDAPNHKRPRISGGWGT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 95 | Phosphorylation | ENKNGVMSPDSPEAE CCCCCCCCCCCCCCC | 24.13 | 22817900 | |
| 98 | Phosphorylation | NGVMSPDSPEAETDY CCCCCCCCCCCCCCC | 28.20 | 7605749 | |
| 108 | Phosphorylation | AETDYTLTPRTEAKY CCCCCCCCCCHHHHH | 11.70 | 27794539 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEF2_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEF2_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEF2_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYC_DROME | dm | genetic | 11546747 | |
| MK14B_DROME | p38b | genetic | 25403440 | |
| CCNE_DROME | CycE | genetic | 11546747 | |
| TWIST_DROME | twi | genetic | 16325168 | |
| BRC1_DROME | br | genetic | 16325168 | |
| BRC4_DROME | br | genetic | 16325168 | |
| PUR6_DROME | ade5 | physical | 25242320 | |
| SCAL_DROME | sd | physical | 18987343 | |
| MEF2_DROME | Mef2 | physical | 19564485 | |
| VG_DROME | vg | physical | 18987343 | |
| TBP_DROME | Tbp | physical | 24075010 | |
| TWIST_DROME | twi | physical | 19500564 | |
| T2FB_DROME | TfIIFbeta | physical | 25242320 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95 AND SER-98, AND MASSSPECTROMETRY. | |
