T2FB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: T2FB_DROME
• UniProt AC: P41900
• Protein Name: General transcription factor IIF subunit 2
• Gene Name: TfIIFbeta
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 277
• Subcellular Localization: Nucleus.
• Protein Description: TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity)..
• Protein Sequence: MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKLRINKTPGQKAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSHMAPSDGKENSTTSAAQPDNEKLYMEGRIVQKLECRPIADNCYMKLKLESIRKASEPQRRVQPIDKIVQNFKPVKDHAHNIEYRERKKAEGKKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNPHKNMWELKKEYRHYKTEEKKEEEHKSGSSDSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Acetylation	VPKYIAQKWEKAPTN EHHHHHHHHHCCCCC	48.58	21791702
171	Acetylation	DKIVQNFKPVKDHAH HHHHHHCCCCCCCCH	57.35	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of T2FB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of T2FB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of T2FB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
T2FA_DROME	TfIIFalpha	physical	7596813

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.