dbPTM

TBP_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TBP_DROME
UniProt AC	P20227
Protein Name	TATA-box-binding protein
Gene Name	Tbp
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	353
Subcellular Localization	Nucleus .
Protein Description	General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II..
Protein Sequence	MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TBP_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TBP_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TBP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TBP_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PC_DROME	Pc	physical	11493924
TAF9_DROME	e(y)1	physical	11438666
TAF10_DROME	Taf10	physical	11438666
PHP_DROME	ph-p	physical	11493924
PHP_DROME	ph-p	physical	11493925
RPB1_DROME	RpII215	physical	22056986
TAF9_DROME	e(y)1	physical	11438676
TAF9_DROME	e(y)1	physical	11493925
TAF9_DROME	e(y)1	physical	7923382
TAF9_DROME	e(y)1	physical	8178153
TAF9_DROME	e(y)1	physical	8276241
TAF11_DROME	Taf11	physical	8276241
TAF11_DROME	Taf11	physical	7923382
TAF11_DROME	Taf11	physical	8178153
PSC_DROME	Psc	physical	11493924
PSC_DROME	Psc	physical	11493925
DCAF1_DROME	mahj	physical	25242320
TAF2_DROME	Taf2	physical	7923382
TAF2_DROME	Taf2	physical	8178153
TAF2_DROME	Taf2	physical	8276241
TAF4_DROME	Taf4	physical	11438676
TAF4_DROME	Taf4	physical	11493925
TAF4_DROME	Taf4	physical	7923382
TAF4_DROME	Taf4	physical	8178153
TAF4_DROME	Taf4	physical	8276241
TAF6_DROME	Taf6	physical	7923382
TAF6_DROME	Taf6	physical	8178153
TAF6_DROME	Taf6	physical	8276241
PC_DROME	Pc	physical	11493925
TAF1_DROME	Taf1	physical	25242320
TAF1_DROME	Taf1	physical	11438676
TAF1_DROME	Taf1	physical	7923382
TAF1_DROME	Taf1	physical	8170939
TAF1_DROME	Taf1	physical	8178153
TAF1_DROME	Taf1	physical	8276241
TAF12_DROME	Taf12	physical	8276241
TAF12_DROME	Taf12	physical	7923382
TAF12_DROME	Taf12	physical	8178153
T2AG_DROME	TfIIA-S	physical	7958898
TF2AA_DROME	TfIIA-L	physical	7958898
TF2AA_DROME	TfIIA-L	physical	8224849
ENY2_DROME	e(y)2	physical	11438676
TAF5_DROME	Taf5	physical	11493925
TAF5_DROME	Taf5	physical	7923382
TAF5_DROME	Taf5	physical	8178153
TAF5_DROME	Taf5	physical	8276241

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TBP_DROME

Related Literatures of Post-Translational Modification