UniProt ID | TAF11_DROME | |
---|---|---|
UniProt AC | P49906 | |
Protein Name | Transcription initiation factor TFIID subunit 11 | |
Gene Name | Taf11 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 196 | |
Subcellular Localization | Nucleus. | |
Protein Description | TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.. | |
Protein Sequence | MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKNTDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYFRLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | LFPTQQKSNSLSDGD CCCCCCCCCCCCCCC | 27.58 | 19429919 | |
14 | Phosphorylation | PTQQKSNSLSDGDDV CCCCCCCCCCCCCCC | 36.02 | 19429919 | |
16 | Phosphorylation | QQKSNSLSDGDDVDL CCCCCCCCCCCCCCH | 39.09 | 19429919 | |
36 | Phosphorylation | ASGERKDSDTSDPGN CCCCCCCCCCCCCCC | 45.91 | 19429919 | |
38 | Phosphorylation | GERKDSDTSDPGNDA CCCCCCCCCCCCCCC | 38.69 | 19429919 | |
39 | Phosphorylation | ERKDSDTSDPGNDAD CCCCCCCCCCCCCCC | 46.96 | 19429919 | |
67 | Phosphorylation | NTDGDGDSGEPAHKK CCCCCCCCCCHHHHH | 51.06 | 19429919 | |
104 | Phosphorylation | TEEQLDRYEMYRRSA CHHHHHHHHHHHHCC | 12.52 | 22817900 | |
107 | Phosphorylation | QLDRYEMYRRSAFPK HHHHHHHHHHCCCCH | 7.31 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF11_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF11_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF11_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NC2B_DROME | NC2beta | physical | 14605208 | |
TAF9_DROME | e(y)1 | physical | 8276241 | |
TAF11_DROME | Taf11 | physical | 26257286 | |
TAF2_DROME | Taf2 | physical | 8276241 | |
AGO2_DROME | AGO2 | physical | 26257286 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14 AND SER-16, AND MASSSPECTROMETRY. |