NC2B_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NC2B_DROME
• UniProt AC: Q9VJQ5
• Protein Name: Protein Dr1
• Gene Name: NC2beta
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 183
• Subcellular Localization: Nucleus .
• Protein Description: Bifunctional basic transcription factor. Activates transcription of DPE (Downstream Promoter Element) containing promoters while repressing transcription of promoters which contain TATA elements..
• Protein Sequence: MSNPQEELLPPSAEDDELTLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	CNMRNKKTINAEHVL HHCCCCCCCCHHHHH	22.52	19429919
112	Phosphorylation	AAKRRRQSTRLENLG HHHHHHHHHHHHHCC	17.43	19429919
113	Phosphorylation	AKRRRQSTRLENLGI HHHHHHHHHHHHCCC	30.82	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NC2B_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NC2B_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NC2B_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MOC2B_DROME	Mocs2	physical	22036573
HCF_DROME	Hcf	physical	22036573
MOC2B_DROME	Mocs2	physical	22345504
JRA_DROME	Jra	physical	20813260

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.