UniProt ID | NC2B_DROME | |
---|---|---|
UniProt AC | Q9VJQ5 | |
Protein Name | Protein Dr1 | |
Gene Name | NC2beta | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 183 | |
Subcellular Localization | Nucleus . | |
Protein Description | Bifunctional basic transcription factor. Activates transcription of DPE (Downstream Promoter Element) containing promoters while repressing transcription of promoters which contain TATA elements.. | |
Protein Sequence | MSNPQEELLPPSAEDDELTLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Phosphorylation | CNMRNKKTINAEHVL HHCCCCCCCCHHHHH | 22.52 | 19429919 | |
112 | Phosphorylation | AAKRRRQSTRLENLG HHHHHHHHHHHHHCC | 17.43 | 19429919 | |
113 | Phosphorylation | AKRRRQSTRLENLGI HHHHHHHHHHHHCCC | 30.82 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NC2B_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NC2B_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NC2B_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MOC2B_DROME | Mocs2 | physical | 22036573 | |
HCF_DROME | Hcf | physical | 22036573 | |
MOC2B_DROME | Mocs2 | physical | 22345504 | |
JRA_DROME | Jra | physical | 20813260 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...