| UniProt ID | MOC2B_DROME | |
|---|---|---|
| UniProt AC | Q9VBX2 | |
| Protein Name | Molybdopterin synthase catalytic subunit {ECO:0000255|HAMAP-Rule:MF_03052} | |
| Gene Name | Mocs2 {ECO:0000255|HAMAP-Rule:MF_03052} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 367 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.. | |
| Protein Sequence | MDHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMNKICSDLRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYDGDNDSEWKENKESIRPKKSKSGFNYAACPCKVEESHDVPRTLVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQNLSDSCARTQSTIIKQEQSNCHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPTKEMRKSLPNSRLQAIESYMGLTTDNEENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPKKSRKKSYSAQELSAFIQKIKDGSELS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 347 | Phosphorylation | PKKSRKKSYSAQELS CCCCCCCCCCHHHHH | 27.62 | 22817900 | |
| 348 | Phosphorylation | KKSRKKSYSAQELSA CCCCCCCCCHHHHHH | 19.53 | 29892262 | |
| 349 | Phosphorylation | KSRKKSYSAQELSAF CCCCCCCCHHHHHHH | 30.48 | 29892262 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOC2B_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOC2B_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOC2B_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MOCS3_DROME | CG13090 | physical | 14605208 | |
| HCF_DROME | Hcf | physical | 22036573 | |
| MOC2B_DROME | Mocs2 | physical | 20813260 | |
| TAD2A_DROME | Ada2a | physical | 20813260 | |
| HCF_DROME | Hcf | physical | 20813260 | |
| NC2B_DROME | NC2beta | physical | 20813260 | |
| WDS_DROME | wds | physical | 20813260 | |
| JRA_DROME | Jra | physical | 20813260 | |
| PROF_DROME | chic | physical | 20813260 | |
| MOCS3_DROME | CG13090 | physical | 22345504 | |
| MOC2B_DROME | Mocs2 | physical | 22345504 | |
| UBA5_DROME | CG1749 | physical | 22345504 | |
| UBA5_DROME | CG1749 | physical | 26705305 | |
| TAD2A_DROME | Ada2a | physical | 18327268 | |
| NC2B_DROME | NC2beta | physical | 18327268 | |
| HCF_DROME | Hcf | physical | 18327268 | |
| WDS_DROME | wds | physical | 18327268 | |
| MOC2A_DROME | CG42503 | physical | 26705305 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
