MOC2A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOC2A_DROME
• UniProt AC: P0C919
• Protein Name: Molybdopterin synthase sulfur carrier subunit {ECO:0000255|HAMAP-Rule:MF_03051}
• Gene Name: Mocs2 {ECO:0000255|HAMAP-Rule:MF_03051}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 90
• Subcellular Localization: Cytoplasm .
• Protein Description: Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin..
• Protein Sequence: MNADGPVVNVHVLFFAKSRELANTPRSTVEVPTEITATELLDHLVSKFGLTSIRDNLILAHNESYIDNLSDRILFKEGDELAIIPPLSGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	1-thioglycine	IIPPLSGG------- EECCCCCC-------	30.86	-
90	Other	IIPPLSGG------- EECCCCCC-------	30.86	-
90	Thiocarboxylation	IIPPLSGG------- EECCCCCC-------	30.86	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOC2A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOC2A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOC2A_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of MOC2A_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.