UniProt ID | MOC2A_DROME | |
---|---|---|
UniProt AC | P0C919 | |
Protein Name | Molybdopterin synthase sulfur carrier subunit {ECO:0000255|HAMAP-Rule:MF_03051} | |
Gene Name | Mocs2 {ECO:0000255|HAMAP-Rule:MF_03051} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 90 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin.. | |
Protein Sequence | MNADGPVVNVHVLFFAKSRELANTPRSTVEVPTEITATELLDHLVSKFGLTSIRDNLILAHNESYIDNLSDRILFKEGDELAIIPPLSGG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOC2A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOC2A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOC2A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MOC2A_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...