TAF12_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAF12_DROME
• UniProt AC: P49905
• Protein Name: Transcription initiation factor TFIID subunit 12
• Gene Name: Taf12
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 196
• Subcellular Localization: Nucleus.
• Protein Description: TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors..
• Protein Sequence: MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TAF12_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAF12_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAF12_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAF12_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUH_DROME	Su(H)	physical	14605208
FACR2_DROME	CG8303	physical	14605208
C1GLT_DROME	C1GalTA	physical	14605208
HPS5_DROME	p	physical	14605208
TAF9_DROME	e(y)1	physical	8276241
TAF4_DROME	Taf4	physical	8276241
TAF12_DROME	Taf12	physical	8276241

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.