ENY2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ENY2_DROME
• UniProt AC: Q9VYX1
• Protein Name: Enhancer of yellow 2 transcription factor {ECO:0000255|HAMAP-Rule:MF_03046}
• Gene Name: e(y)2 {ECO:0000255|HAMAP-Rule:MF_03046}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 101
• Subcellular Localization: Nucleus, nucleoplasm. Nucleus, nuclear pore complex. Cytoplasm. Localizes to nuclear periphery, in contact with the nuclear pore complex (NPC).
• Protein Description: Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Recruited to the su(Hw) insulators via its interaction with su(Hw) and participates in the barrier activity of such insulators. In contrast, it does not participate in the enhancer-blocking activity of the su(Hw) insulators..
• Protein Sequence: MSTSGAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTILTEIEEEPDEPEDES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTSGAVDQ ------CCCCCCCCE	31.14	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ENY2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ENY2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ENY2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF9_DROME	e(y)1	physical	11438676
TAF10_DROME	Taf10	physical	18034162
TAF10_DROME	Taf10	physical	19947544
ORC5_DROME	Orc5	physical	27016737
TRA1_DROME	Nipped-A	physical	18034162
TRA1_DROME	Nipped-A	physical	19947544
ORC1_DROME	Orc1	physical	27016737
ORC6_DROME	Orc6	physical	27016737
TBB1_DROME	betaTub56D	physical	22989713
TBP_DROME	Tbp	physical	11438676
THOC5_DROME	thoc5	physical	20048002
THOC7_DROME	thoc7	physical	20048002
RAS2_DROME	Ras64B	physical	22989713
PCID2_DROME	PCID2	physical	27016737
THOC6_DROME	thoc6	physical	20048002
TAF4_DROME	Taf4	physical	11438676
NOT_DROME	not	physical	22989713
SGF11_DROME	Sgf11	physical	22989713
TAF1_DROME	Taf1	physical	11438676
TAD2B_DROME	Ada2b	physical	18034162
TAD2B_DROME	Ada2b	physical	19947544
ORC2_DROME	Orc2	physical	27016737
XMAS2_DROME	xmas-2	physical	27016737
XMAS2_DROME	xmas-2	physical	18034162
XMAS2_DROME	xmas-2	physical	19947544
XMAS2_DROME	xmas-2	physical	20048002
HSP71_DROME	Hsp70Ab	physical	22989713
HSP70_DROME	Hsp70Ab	physical	22989713
HSP72_DROME	Hsp70Ba	physical	22989713
HSP75_DROME	Hsp70Bb	physical	22989713
HSP73_DROME	Hsp70Bb	physical	22989713
HSP74_DROME	Hsp70Bbb	physical	22989713

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.