dbPTM

NOT_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NOT_DROME
UniProt AC	Q9VVR1
Protein Name	Ubiquitin carboxyl-terminal hydrolase nonstop
Gene Name	not
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	496
Subcellular Localization	Nucleus .
Protein Description	Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of histone H2B, thereby acting as a coactivator in a large subset of genes. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad..
Protein Sequence	MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEYE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NOT_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NOT_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NOT_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NOT_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SGF11_DROME	Sgf11	physical	18188155
UBIQP_DROME	Ubi-p63E	physical	24493646
PSB1_DROME	Prosbeta6	genetic	11182084
SGF11_DROME	Sgf11	physical	22989713
ENY2_DROME	e(y)2	physical	22989713

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NOT_DROME

Related Literatures of Post-Translational Modification