| UniProt ID | ORC6_DROME | |
|---|---|---|
| UniProt AC | Q9Y1B2 | |
| Protein Name | Origin recognition complex subunit 6 | |
| Gene Name | Orc6 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 257 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).. | |
| Protein Sequence | MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHMDSQLLEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ORC6_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORC6_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORC6_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORC6_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DLL_DROME | Dll | physical | 15575970 | |
| FTF1B_DROME | Hr39 | physical | 15575970 | |
| ORC5_DROME | Orc5 | physical | 24137536 | |
| ORC5_DROME | Orc5 | physical | 27016737 | |
| ORC1_DROME | Orc1 | physical | 24137536 | |
| PNUT_DROME | pnut | physical | 12878722 | |
| PNUT_DROME | pnut | physical | 18987337 | |
| PNUT_DROME | pnut | physical | 25355953 | |
| ORC6_DROME | Orc6 | physical | 25355953 | |
| ORC2_DROME | Orc2 | physical | 24137536 | |
| ORC2_DROME | Orc2 | physical | 27016737 | |
| XMAS2_DROME | xmas-2 | physical | 27016737 | |
| ENY2_DROME | e(y)2 | physical | 27016737 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
