UniProt ID | ORC6_DROME | |
---|---|---|
UniProt AC | Q9Y1B2 | |
Protein Name | Origin recognition complex subunit 6 | |
Gene Name | Orc6 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 257 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).. | |
Protein Sequence | MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHMDSQLLEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ORC6_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORC6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORC6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORC6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DLL_DROME | Dll | physical | 15575970 | |
FTF1B_DROME | Hr39 | physical | 15575970 | |
ORC5_DROME | Orc5 | physical | 24137536 | |
ORC5_DROME | Orc5 | physical | 27016737 | |
ORC1_DROME | Orc1 | physical | 24137536 | |
PNUT_DROME | pnut | physical | 12878722 | |
PNUT_DROME | pnut | physical | 18987337 | |
PNUT_DROME | pnut | physical | 25355953 | |
ORC6_DROME | Orc6 | physical | 25355953 | |
ORC2_DROME | Orc2 | physical | 24137536 | |
ORC2_DROME | Orc2 | physical | 27016737 | |
XMAS2_DROME | xmas-2 | physical | 27016737 | |
ENY2_DROME | e(y)2 | physical | 27016737 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...