UniProt ID | DLL_DROME | |
---|---|---|
UniProt AC | P20009 | |
Protein Name | Homeotic protein distal-less | |
Gene Name | Dll | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 327 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that plays a role in larval and adult appendage development. Specifies the identity of ventral appendages (including legs and antennae) and suppresses dorsal appendage development. Involved in patterning the distal-proximal limb axis. May control the adhesive properties of cells during limb morphogenesis. Also has a secondary role in the normal patterning of the wing margin.. | |
Protein Sequence | MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVTVWPAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DLL_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLL_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLL_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLL_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TERM_DROME | term | physical | 14605208 | |
DISC_DROME | disco | genetic | 19756755 | |
HTH_DROME | hth | genetic | 10603339 | |
DLL_DROME | Dll | physical | 23935523 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...