dbPTM

DLL_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DLL_DROME
UniProt AC	P20009
Protein Name	Homeotic protein distal-less
Gene Name	Dll
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	327
Subcellular Localization	Nucleus .
Protein Description	Transcription factor that plays a role in larval and adult appendage development. Specifies the identity of ventral appendages (including legs and antennae) and suppresses dorsal appendage development. Involved in patterning the distal-proximal limb axis. May control the adhesive properties of cells during limb morphogenesis. Also has a secondary role in the normal patterning of the wing margin..
Protein Sequence	MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSLVTVWPAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DLL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DLL_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DLL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DLL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERM_DROME	term	physical	14605208
DISC_DROME	disco	genetic	19756755
HTH_DROME	hth	genetic	10603339
DLL_DROME	Dll	physical	23935523

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DLL_DROME

Related Literatures of Post-Translational Modification