| UniProt ID | HTH_DROME | |
|---|---|---|
| UniProt AC | O46339 | |
| Protein Name | Homeobox protein homothorax | |
| Gene Name | hth {ECO:0000312|FlyBase:FBgn0001235} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 487 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | All isoforms are required for patterning of the embryonic cuticle. Acts with exd to delimit the eye field and prevent inappropriate eye development. Isoforms that carry the homeodomain are required for proper localization of chordotonal organs within the peripheral nervous system and antennal identity; required to activate antennal-specific genes, such as sal and to repress the leg-like expression of dac. Necessary for the nuclear localization of the essential HOX cofactor, extradenticle (exd). Both necessary and sufficient for inner photoreceptors to adopt the polarization-sensitive 'dorsal rim area' (DRA) of the eye fate instead of the color-sensitive default state. This occurs by increasing rhabdomere size and uncoupling R7-R8 communication to allow both cells to express the same opsin rather than different ones as required for color vision.. | |
| Protein Sequence | MAQPRYDDGLHGYGMDSGAAAAAMYDPHAGHRPPGLQGLPSHHSPHMTHAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPGFHQGYPHYPPAEYYGQHL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of HTH_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HTH_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HTH_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HTH_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAMO_DROME | tamo | physical | 14605208 | |
| EXD_DROME | exd | physical | 14605208 | |
| GOGA5_DROME | Golgin84 | physical | 14605208 | |
| KPC3_DROME | Pkc98E | physical | 14605208 | |
| CH60B_DROME | Hsp60B | physical | 14605208 | |
| HRS_DROME | Hrs | physical | 14605208 | |
| SXL_DROME | Sxl | physical | 14605208 | |
| JING_DROME | jing | genetic | 16510782 | |
| EXD_DROME | exd | physical | 10215621 | |
| EXD_DROME | exd | physical | 10529430 | |
| EXD_DROME | exd | physical | 12231630 | |
| EXD_DROME | exd | physical | 9346235 | |
| EXD_DROME | exd | physical | 23637332 | |
| TSH_DROME | tsh | physical | 12231630 | |
| LAB_DROME | lab | physical | 10529430 | |
| UBX_DROME | Ubx | physical | 22975331 | |
| PAX6_DROME | ey | physical | 12231630 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
