UniProt ID | SXL_DROME | |
---|---|---|
UniProt AC | P19339 | |
Protein Name | Protein sex-lethal | |
Gene Name | Sxl | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 354 | |
Subcellular Localization | ||
Protein Description | Sex determination switch protein which controls sexual development by sex-specific splicing. Regulates dosage compensation in females by suppressing hyperactivation of X-linked genes. Expression of the embryo-specific isoform is under the control of primary sex-determining signal, which depends on the ratio of X chromosomes relative to autosomes (X:A ratio). Expression occurs in 2X:2A cells, but not in X:2A cells. The X:A ratio seems to be signaled by the relative concentration of the X-linked transcription factors SIS-A and SIS-B. As a result, the embryo-specific product is expressed early only in female embryos and specifies female-adult specific splicing; in the male where it is not expressed, the default splicing gives rise to a truncated non-functional protein. The female-specific isoform specifies the splicing of its own transcript, thereby initiating a positive autoregulatory feedback loop leading to female development pathway. The female-specific isoform controls the sex-specific splicing of transformer (TRA); acts as a translational repressor for male-specific lethal-2 (MSL-2) and prevents male-less (MLE), MSL-1 and MSL-3 proteins from associating with the female X chromosome.. | |
Protein Sequence | MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 (in isoform 12) | Phosphorylation | - | 21.36 | 21082442 | |
32 (in isoform 6) | Phosphorylation | - | 21.36 | 21082442 | |
32 (in isoform 8) | Phosphorylation | - | 21.36 | 21082442 | |
34 (in isoform 12) | Phosphorylation | - | 15.42 | 21082442 | |
34 (in isoform 4) | Phosphorylation | - | 15.42 | 21082442 | |
34 (in isoform 6) | Phosphorylation | - | 15.42 | 21082442 | |
34 (in isoform 7) | Phosphorylation | - | 15.42 | 21082442 | |
34 (in isoform 8) | Phosphorylation | - | 15.42 | 21082442 | |
34 (in isoform 9) | Phosphorylation | - | 15.42 | 21082442 | |
36 | Phosphorylation | RGFGMSHSLPSGMSR CCCCCCCCCCCCCCC | 34.37 | 21082442 | |
36 (in isoform 4) | Phosphorylation | - | 34.37 | 21082442 | |
36 (in isoform 7) | Phosphorylation | - | 34.37 | 21082442 | |
36 (in isoform 9) | Phosphorylation | - | 34.37 | 21082442 | |
39 | Phosphorylation | GMSHSLPSGMSRYAF CCCCCCCCCCCCCCC | 53.04 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SXL_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SXL_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SXL_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...