IF4E_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IF4E_DROME
• UniProt AC: P48598
• Protein Name: Eukaryotic translation initiation factor 4E1
• Gene Name: eIF4E1 {ECO:0000312|FlyBase:FBgn0015218}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 259
• Protein Description: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures..
• Protein Sequence: MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	NPKSMFKTSAPSTEQ CHHHHHCCCCCCCCC	20.89	19429919
21	Phosphorylation	PKSMFKTSAPSTEQG HHHHHCCCCCCCCCC	38.48	19429919
24	Phosphorylation	MFKTSAPSTEQGRPE HHCCCCCCCCCCCCC	44.27	19429919
25	Phosphorylation	FKTSAPSTEQGRPEP HCCCCCCCCCCCCCC	31.13	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
251	S	Phosphorylation	Kinase	LK6	Q9VGI4	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IF4E_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IF4E_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OB10_DROME	a10	physical	14605208
CUP_DROME	cup	physical	14685270
CUP_DROME	cup	genetic	26102195
PUM_DROME	pum	genetic	15541314
CUP_DROME	cup	physical	14723848
CUP_DROME	cup	physical	15465908
CUP_DROME	cup	physical	25179781
CUP_DROME	cup	physical	26294658
CUP_DROME	cup	physical	22832024
DDX6_DROME	me31B	physical	14723848
PABP_DROME	pAbp	physical	21331043
SXL_DROME	Sxl	physical	21829374
DIAP1_DROME	th	physical	18182863
DDX3_DROME	bel	physical	21788736

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.