UniProt ID | IF4E_DROME | |
---|---|---|
UniProt AC | P48598 | |
Protein Name | Eukaryotic translation initiation factor 4E1 | |
Gene Name | eIF4E1 {ECO:0000312|FlyBase:FBgn0015218} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 259 | |
Subcellular Localization | ||
Protein Description | Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.. | |
Protein Sequence | MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | NPKSMFKTSAPSTEQ CHHHHHCCCCCCCCC | 20.89 | 19429919 | |
21 | Phosphorylation | PKSMFKTSAPSTEQG HHHHHCCCCCCCCCC | 38.48 | 19429919 | |
24 | Phosphorylation | MFKTSAPSTEQGRPE HHCCCCCCCCCCCCC | 44.27 | 19429919 | |
25 | Phosphorylation | FKTSAPSTEQGRPEP HCCCCCCCCCCCCCC | 31.13 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
251 | S | Phosphorylation | Kinase | LK6 | Q9VGI4 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF4E_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF4E_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
OB10_DROME | a10 | physical | 14605208 | |
CUP_DROME | cup | physical | 14685270 | |
CUP_DROME | cup | genetic | 26102195 | |
PUM_DROME | pum | genetic | 15541314 | |
CUP_DROME | cup | physical | 14723848 | |
CUP_DROME | cup | physical | 15465908 | |
CUP_DROME | cup | physical | 25179781 | |
CUP_DROME | cup | physical | 26294658 | |
CUP_DROME | cup | physical | 22832024 | |
DDX6_DROME | me31B | physical | 14723848 | |
PABP_DROME | pAbp | physical | 21331043 | |
SXL_DROME | Sxl | physical | 21829374 | |
DIAP1_DROME | th | physical | 18182863 | |
DDX3_DROME | bel | physical | 21788736 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...