UniProt ID | DDX6_DROME | |
---|---|---|
UniProt AC | P23128 | |
Protein Name | Putative ATP-dependent RNA helicase me31b | |
Gene Name | me31B | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 459 | |
Subcellular Localization | Cytoplasm . Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis. | |
Protein Description | Unwinds RNA in an ATP-dependent fashion (Potential). Involved in germ cell formation.. | |
Protein Sequence | MMTEKLNSGHTNLTSKGIINDLQIAGNTSDDMGWKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVANVGASVGDTCNNSDLNNSANEEGNVSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MMTEKLNSGHTNLTS CCCCCCCCCCCCCCC | 42.25 | 22817900 | |
29 | Phosphorylation | LQIAGNTSDDMGWKS EEECCCCCCCCCCCC | 35.30 | 22817900 | |
161 | Phosphorylation | DIRVMVTTGGTILKD CEEEEEEECCCCCHH | 23.39 | 21082442 | |
164 | Phosphorylation | VMVTTGGTILKDDIL EEEEECCCCCHHHHH | 25.20 | 21082442 | |
412 | Acetylation | FDLHRIEKELGTEIK CCHHHHHHHHCCCCC | 56.73 | 21791702 | |
441 | Phosphorylation | VGASVGDTCNNSDLN CCCCCCCCCCCCCCC | 15.94 | 19429919 | |
445 | Phosphorylation | VGDTCNNSDLNNSAN CCCCCCCCCCCCCCC | 29.50 | 19429919 | |
450 | Phosphorylation | NNSDLNNSANEEGNV CCCCCCCCCCCCCCC | 31.25 | 19285948 | |
458 | Phosphorylation | ANEEGNVSK------ CCCCCCCCC------ | 36.33 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DDX6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DDX6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DDX6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MSL2_DROME | msl-2 | physical | 23788626 | |
CUP_DROME | cup | physical | 14723848 | |
GRK_DROME | grk | physical | 23213441 | |
EXU_DROME | exu | physical | 14723848 | |
EXU_DROME | exu | physical | 11546740 | |
NANOS_DROME | nos | physical | 21081899 | |
IF4E_DROME | eIF-4E | physical | 14723848 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8; SER-29 AND SER-450,AND MASS SPECTROMETRY. |