GBLP_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBLP_DROME
• UniProt AC: O18640
• Protein Name: Guanine nucleotide-binding protein subunit beta-like protein
• Gene Name: Rack1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 318
• Protein Description: Involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Interacts with a wide variety of proteins and plays a role in many cellular processes (By similarity)..
• Protein Sequence: MSETLQLRGTLIGHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRLYGHSHFISDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNHHGHNGYLNTVTVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLEHNDIINALCFSPNRYWLCVAYGPSIKIWDLACKKTVEELRPEVVSPTSKADQPQCLSLAWSTDGQTLFAGYSDNTIRVWQVSVSAH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Acetylation	GSRDKTIKLWNTLAE CCCCHHHHHHHHHHC	53.32	21791702
266	Acetylation	IWDLACKKTVEELRP HHHHHCCHHHHHHCH	58.65	21791702
277	Phosphorylation	ELRPEVVSPTSKADQ HHCHHHCCCCCCCCC	27.86	28490779
316	Phosphorylation	RVWQVSVSAH----- EEEEEEEECC-----	17.08	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBLP_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBLP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBLP_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EXD_DROME	exd	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.