dbPTM

FL2D_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FL2D_DROME
UniProt AC	Q9Y091
Protein Name	Pre-mRNA-splicing regulator female-lethal(2)D {ECO:0000303\|PubMed:10790389}
Gene Name	fl(2)d {ECO:0000303\|PubMed:10790389, ECO:0000312\|FlyBase:FBgn0000662}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	536
Subcellular Localization	Nucleus .
Protein Description	Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and is required for sex determination. [PubMed: 27919077 Required for sex determination and dosage compensation via Sxl alternative splicing: m6A methylation acts as a key regulator of Sxl pre-mRNA and promotes female-specific alternative splicing of Sxl, which determines female physiognomy]
Protein Sequence	MSVAAMTMDDQRPCMNSYDKMPPTKYEQNLNILNSSQNSGATGGPASPTPSGLEDHHHHHHPHPHHHHHQEQQQQQQQQQHLQQQQQQQQQQHAAAVAEAVAAAEQRQRLLEDEIENLKLEQVRMAQQCADAQRREKILMRRLANKEQEFQDYVSQIAEYKAQQAPTALALRTALLDPAVNLLFERLKKELKATKAKLEETQNELSAWKFTPDSNTGKRLMAKCRLLYQENEELGKMTSNGRLAKLETELAMQKSFSEEVKKSQSELDDFLQELDEDVEGMQSTILFLQQELKTTRDRIQTLEKENAQLKQAIKDEVVAPAAATNGGTNTTINKLETIHEDACMANNPTNPDCYNGNTNNEQIAAVPQIPLSDDGSNMNGNAARLARKRNYQEEEALPTVVVVPTPTPVGNNVQEAPPIREVTAPRTLPPKKSKLRGITTRRNSQLEEDHQPVTTPVAVPMIVDNAVAGMASEEAAAAAAAVNNSNTGIIPETGVQVGVPVEGGDPGAPAAPGRILTRRRSVRMQQNGSGAVDYST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FL2D_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FL2D_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FL2D_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FL2D_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NUP88_DROME	mbo	physical	14605208
VIR_DROME	vir	physical	12444081
VIR_DROME	vir	physical	22036573
SO_DROME	so	physical	24690230
IF4E_DROME	eIF-4E	physical	21829374

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FL2D_DROME

Related Literatures of Post-Translational Modification