UniProt ID | FL2D_DROME | |
---|---|---|
UniProt AC | Q9Y091 | |
Protein Name | Pre-mRNA-splicing regulator female-lethal(2)D {ECO:0000303|PubMed:10790389} | |
Gene Name | fl(2)d {ECO:0000303|PubMed:10790389, ECO:0000312|FlyBase:FBgn0000662} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 536 | |
Subcellular Localization | Nucleus . | |
Protein Description | Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and is required for sex determination. [PubMed: 27919077 Required for sex determination and dosage compensation via Sxl alternative splicing: m6A methylation acts as a key regulator of Sxl pre-mRNA and promotes female-specific alternative splicing of Sxl, which determines female physiognomy] | |
Protein Sequence | MSVAAMTMDDQRPCMNSYDKMPPTKYEQNLNILNSSQNSGATGGPASPTPSGLEDHHHHHHPHPHHHHHQEQQQQQQQQQHLQQQQQQQQQQHAAAVAEAVAAAEQRQRLLEDEIENLKLEQVRMAQQCADAQRREKILMRRLANKEQEFQDYVSQIAEYKAQQAPTALALRTALLDPAVNLLFERLKKELKATKAKLEETQNELSAWKFTPDSNTGKRLMAKCRLLYQENEELGKMTSNGRLAKLETELAMQKSFSEEVKKSQSELDDFLQELDEDVEGMQSTILFLQQELKTTRDRIQTLEKENAQLKQAIKDEVVAPAAATNGGTNTTINKLETIHEDACMANNPTNPDCYNGNTNNEQIAAVPQIPLSDDGSNMNGNAARLARKRNYQEEEALPTVVVVPTPTPVGNNVQEAPPIREVTAPRTLPPKKSKLRGITTRRNSQLEEDHQPVTTPVAVPMIVDNAVAGMASEEAAAAAAAVNNSNTGIIPETGVQVGVPVEGGDPGAPAAPGRILTRRRSVRMQQNGSGAVDYST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FL2D_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FL2D_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FL2D_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FL2D_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NUP88_DROME | mbo | physical | 14605208 | |
VIR_DROME | vir | physical | 12444081 | |
VIR_DROME | vir | physical | 22036573 | |
SO_DROME | so | physical | 24690230 | |
IF4E_DROME | eIF-4E | physical | 21829374 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...