UniProt ID | SO_DROME | |
---|---|---|
UniProt AC | Q27350 | |
Protein Name | Protein sine oculis | |
Gene Name | so | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 416 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for visual system development. May transcriptionally regulate genes necessary for optic lobe invagination and Bolwig's nerve formation.. | |
Protein Sequence | MLQHPATDFYDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGRENLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQGLQHHPHQPHPASNIANVAATKSSGGGGGGGVSAAAAAQMQMPPLTAAVAYSHLHSVMGAMPMTAMYDMGEYQHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SO_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SO_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SO_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SO_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VA0D1_DROME | VhaAC39-1 | physical | 14605208 | |
BOP1_DROME | CG5033 | physical | 14605208 | |
GROU_DROME | gro | physical | 14605208 | |
EYA_DROME | eya | physical | 14605208 | |
HPF1_DROME | CG1218 | physical | 14605208 | |
CSK2B_DROME | CkIIbeta | physical | 14605208 | |
C3390_DROME | CG33090 | physical | 14605208 | |
ABRU_DROME | ab | physical | 14605208 | |
CLH_DROME | Chc | physical | 14605208 | |
EYA_DROME | eya | genetic | 24690230 | |
FL2D_DROME | fl(2)d | genetic | 24690230 | |
GLAS_DROME | gl | genetic | 12417651 | |
CRY1_DROME | cry | genetic | 12417651 | |
EYA_DROME | eya | physical | 16125693 | |
FL2D_DROME | fl(2)d | physical | 24690230 | |
GROU_DROME | gro | physical | 16125693 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...