| UniProt ID | SO_DROME | |
|---|---|---|
| UniProt AC | Q27350 | |
| Protein Name | Protein sine oculis | |
| Gene Name | so | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 416 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for visual system development. May transcriptionally regulate genes necessary for optic lobe invagination and Bolwig's nerve formation.. | |
| Protein Sequence | MLQHPATDFYDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGRENLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQGLQHHPHQPHPASNIANVAATKSSGGGGGGGVSAAAAAQMQMPPLTAAVAYSHLHSVMGAMPMTAMYDMGEYQHL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SO_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SO_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SO_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SO_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VA0D1_DROME | VhaAC39-1 | physical | 14605208 | |
| BOP1_DROME | CG5033 | physical | 14605208 | |
| GROU_DROME | gro | physical | 14605208 | |
| EYA_DROME | eya | physical | 14605208 | |
| HPF1_DROME | CG1218 | physical | 14605208 | |
| CSK2B_DROME | CkIIbeta | physical | 14605208 | |
| C3390_DROME | CG33090 | physical | 14605208 | |
| ABRU_DROME | ab | physical | 14605208 | |
| CLH_DROME | Chc | physical | 14605208 | |
| EYA_DROME | eya | genetic | 24690230 | |
| FL2D_DROME | fl(2)d | genetic | 24690230 | |
| GLAS_DROME | gl | genetic | 12417651 | |
| CRY1_DROME | cry | genetic | 12417651 | |
| EYA_DROME | eya | physical | 16125693 | |
| FL2D_DROME | fl(2)d | physical | 24690230 | |
| GROU_DROME | gro | physical | 16125693 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
