CRY1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRY1_DROME
• UniProt AC: O77059
• Protein Name: Cryptochrome-1
• Gene Name: cry {ECO:0000312|EMBL:AAF55649.1, ECO:0000312|FlyBase:FBgn0025680}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 542
• Subcellular Localization: Cytoplasm . Cytoplasm, perinuclear region . Nucleus . Nuclear translocation initiates after the perception of a light signal. Accumulates in the perinuclear region about one hour before translocation into the nucleus. Translocation occurs through int
• Protein Description: Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry. Necessary for light-dependent magnetosensitivity, an intact circadian system is not required for the magnetoreception mechanism to operate. Required for both the naive and trained responses to magnetic field, consistent with the notion that cry is in the input pathway of magnetic sensing..
• Protein Sequence: MATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADVVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CRY1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRY1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRY1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRY1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HMOC_DROME	oc	physical	15710747
PER_DROME	per	genetic	16361445
PIPA_DROME	norpA	genetic	10839367
PIPA_DROME	norpA	genetic	22306971
PIPA_DROME	norpA	genetic	14960620
EYA_DROME	eya	genetic	16510731
5HT2B_DROME	5-HT1B	genetic	15996552
HID_DROME	W	genetic	14960620
GLAS_DROME	gl	genetic	14960620
OPS1_DROME	ninaE	genetic	19398933
SGG_DROME	sgg	physical	17418796
PER_DROME	per	physical	11448767
PER_DROME	per	physical	10417378
PER_DROME	per	physical	23479607
DGK2_DROME	rdgA	physical	23536301
TIM_DROME	tim	physical	10417378
TIM_DROME	tim	physical	11448767
TIM_DROME	tim	physical	23479607
NINAC_DROME	ninaC	physical	23536301
INAD_DROME	inaD	physical	23536301

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.