UniProt ID | SGG_DROME | |
---|---|---|
UniProt AC | P18431 | |
Protein Name | Protein kinase shaggy | |
Gene Name | sgg | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 514 | |
Subcellular Localization | Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cell cortex. Cell junction, synapse. Cell projection, axon. In syncytial embryos, detected at the centrosomes throughout the cell cycle, and in the mit | |
Protein Description | Required for several developmental events such as syncytial blastoderm formation and embryonic segmentation. Is involved in transcriptional regulation. Required for arm phosphorylation. Wg signaling operates by inactivating the sgg repression of en autoactivation. Negatively controls the neuromuscular junction (NMJ) growth in presynaptic motoneurons. Plays a role in the regulation of microtubule dynamics and actin cytoskeleton during embryogenesis. Required for phosphorylation of sra in activated eggs. Essential for completion of meiosis, possibly by triggering calcineurin activation via sra phosphorylation. Phosphorylates microtubule-associated protein futsch in axons.. | |
Protein Sequence | MSGRPRTSSFAEGNKQSPSLVLGGVKTCSRDGSKITTVVATPGQGTDRVQEVSYTDTKVIGNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKNRELQIMRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLFNFTEHELSIQPSLVPQLLPKHLQNASGPGGNRPSAGGAASIAASGSTSVSSTGSGASVEGSAQPQSQGTAAAAGSGSGGATAGTGGASAGGPGSGNNSSSGGASGAPSAVAAGGANAAVAGGAGGGGGAGAATAAATATGAIGATNAGGANVTDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGRPRTSS ------CCCCCCCCC | 25.59 | 27794539 | |
7 (in isoform 4) | Phosphorylation | - | 17.61 | 19429919 | |
7 | Phosphorylation | -MSGRPRTSSFAEGN -CCCCCCCCCCCCCC | 17.61 | 19429919 | |
8 | Phosphorylation | MSGRPRTSSFAEGNK CCCCCCCCCCCCCCC | 31.00 | 19429919 | |
9 | Phosphorylation | SGRPRTSSFAEGNKQ CCCCCCCCCCCCCCC | 32.66 | 19429919 | |
17 | Phosphorylation | FAEGNKQSPSLVLGG CCCCCCCCCCEEECC | 41.46 | 28490779 | |
93 (in isoform 1) | Phosphorylation | - | 34.33 | 21082442 | |
94 (in isoform 1) | Phosphorylation | - | 39.74 | 21082442 | |
95 (in isoform 1) | Phosphorylation | - | 33.38 | 21082442 | |
124 (in isoform 1) | Phosphorylation | - | 33.75 | 21082442 | |
213 | Phosphorylation | LHGEPNVSYICSRYY HCCCCCHHHHHCCCC | 45.58 | 19429919 | |
214 | Phosphorylation | HGEPNVSYICSRYYR CCCCCHHHHHCCCCC | 14.06 | 21082442 | |
214 (in isoform 1) | Phosphorylation | - | 14.06 | 8382613 | |
216 (in isoform 1) | Phosphorylation | - | 29.72 | 19429919 | |
217 | Phosphorylation | PNVSYICSRYYRAPE CCHHHHHCCCCCCCH | 29.09 | 19429919 | |
219 (in isoform 1) | Phosphorylation | - | 28.44 | 19429919 | |
329 (in isoform 1) | Phosphorylation | - | 25.59 | 21082442 | |
372 (in isoform 1) | Phosphorylation | - | 24.96 | 19429919 | |
566 (in isoform 1) | Phosphorylation | - | 18.84 | 21082442 | |
766 | Phosphorylation | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 18.54 | 18327897 | |
767 | Phosphorylation | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 11.15 | 18327897 | |
770 | Phosphorylation | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 17.48 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGG_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGG_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGG_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-766; TYR-767 ANDSER-770, AND MASS SPECTROMETRY. | |
"Modulation of the glycogen synthase kinase-3 family by tyrosinephosphorylation."; Hughes K., Nikolakaki E., Plyte S.E., Totty N.F., Woodgett J.R.; EMBO J. 12:803-808(1993). Cited for: PHOSPHORYLATION AT TYR-767. |