UniProt ID | RSSA_DROME | |
---|---|---|
UniProt AC | P38979 | |
Protein Name | 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015} | |
Gene Name | sta {ECO:0000255|HAMAP-Rule:MF_03015} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 270 | |
Subcellular Localization | Cytoplasm . Nucleus . May associate with nascent RNP complexes within the nucleus. | |
Protein Description | Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Required during oogenesis and imaginal development.. | |
Protein Sequence | MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEETTNWADEVAAETVGGVEDWNEDTVKTSWGSDGQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGGLDILS ------CCCCCEEEE | 3.31 | 28490779 | |
104 | Phosphorylation | TPIAGRFTPGAFTNQ CCCCCCCCCCHHHHC | 5.07 | 21082442 | |
132 | Acetylation | TDPNTDHQPIMEASY CCCCCCCCCCHHCEE | 36.36 | 21791702 | |
135 | Acetylation | NTDHQPIMEASYVNI CCCCCCCHHCEEEEC | 52.39 | 21791702 | |
147 | Phosphorylation | VNIPVIAFTNTDSPL EECCEEEEECCCCCC | 21.32 | 22817900 | |
266 | Phosphorylation | TVKTSWGSDGQF--- CCCCCCCCCCCC--- | 42.67 | 19429919 | |
309 | Phosphorylation | ---------------------------------------------- ---------------------------------------------- | 32.10 | 19060867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSSA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSSA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSSA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POXM_DROME | Poxm | physical | 14605208 | |
RS21_DROME | RpS21 | genetic | 10022917 | |
RS21_DROME | RpS21 | physical | 10022917 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...