RSSA_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSSA_DROME
• UniProt AC: P38979
• Protein Name: 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015}
• Gene Name: sta {ECO:0000255|HAMAP-Rule:MF_03015}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 270
• Subcellular Localization: Cytoplasm . Nucleus . May associate with nascent RNP complexes within the nucleus.
• Protein Description: Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Required during oogenesis and imaginal development..
• Protein Sequence: MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEETTNWADEVAAETVGGVEDWNEDTVKTSWGSDGQF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSGGLDILS ------CCCCCEEEE	3.31	28490779
104	Phosphorylation	TPIAGRFTPGAFTNQ CCCCCCCCCCHHHHC	5.07	21082442
132	Acetylation	TDPNTDHQPIMEASY CCCCCCCCCCHHCEE	36.36	21791702
135	Acetylation	NTDHQPIMEASYVNI CCCCCCCHHCEEEEC	52.39	21791702
147	Phosphorylation	VNIPVIAFTNTDSPL EECCEEEEECCCCCC	21.32	22817900
266	Phosphorylation	TVKTSWGSDGQF--- CCCCCCCCCCCC---	42.67	19429919
309	Phosphorylation	---------------------------------------------- ----------------------------------------------	32.10	19060867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSSA_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSSA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSSA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
POXM_DROME	Poxm	physical	14605208
RS21_DROME	RpS21	genetic	10022917
RS21_DROME	RpS21	physical	10022917

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.