dbPTM

POXM_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	POXM_DROME
UniProt AC	P23757
Protein Name	Paired box pox-meso protein
Gene Name	Poxm
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	370
Subcellular Localization	Nucleus .
Protein Description
Protein Sequence	MDPESQCPQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMGGMGSTVSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGMHHHHHHGGMMAAGATGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of POXM_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of POXM_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of POXM_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of POXM_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MYC_DROME	dm	genetic	11546747
CCNE_DROME	CycE	genetic	11546747

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of POXM_DROME

Related Literatures of Post-Translational Modification