dbPTM

OPS1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OPS1_DROME
UniProt AC	P06002
Protein Name	Opsin Rh1
Gene Name	ninaE
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	373
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal..
Protein Sequence	MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEAESKA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	N-linked_Glycosylation	PHFAPLSNGSVVDKV CCEECCCCCCEECCC	55.21	-
196	N-linked_Glycosylation	SRYVPEGNLTSCGID CCCCCCCCCCCCCCH	38.18	17893096
259	Phosphorylation	AKKMNVKSLRSSEDA HHHCCHHHHCCCHHH	25.40	27794539
319	Other	IWGACFAKSAACYNP HHHHHHHHHHHHCCC	22.00	-
356	Ubiquitination	FGKVDDGKSSDAQSQ EEECCCCCCCCHHHH	54.50	31113955
357	Phosphorylation	GKVDDGKSSDAQSQA EECCCCCCCCHHHHH	38.69	27794539
358	Phosphorylation	KVDDGKSSDAQSQAT ECCCCCCCCHHHHHH	40.21	27794539
362	Phosphorylation	GKSSDAQSQATASEA CCCCCHHHHHHHHHH	24.41	27794539
365	Phosphorylation	SDAQSQATASEAESK CCHHHHHHHHHHHHH	24.07	27794539
367	Phosphorylation	AQSQATASEAESKA- HHHHHHHHHHHHHC-	32.74	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OPS1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OPS1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OPS1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CYPR_DROME	ninaA	physical	7957056
INAD_DROME	inaD	physical	9010208
TRP_DROME	trp	physical	9010208
PIPA_DROME	norpA	genetic	15014127
CDC42_DROME	Cdc42	genetic	11110667
OPS5_DROME	Rh5	genetic	8982159
OPS5_DROME	Rh5	genetic	10594055
OPS5_DROME	Rh5	genetic	21393546
TERA_DROME	TER94	genetic	20865169
GNAQ_DROME	Galphaq	genetic	15014127
CDK5_DROME	Cdk5	genetic	22388889
CDK5_DROME	Cdk5	genetic	26662796
RAC1_DROME	Rac1	genetic	11110667
ARRB_DROME	Arr2	genetic	15014127
DRONC_DROME	Nc	genetic	24553922
ARL1_DROME	Arl1	genetic	21693198
OPS4_DROME	Rh4	genetic	1403087
OPS4_DROME	Rh4	genetic	21393546
HID_DROME	W	genetic	24553922
OPS6_DROME	Rh6	genetic	19398933
OPS6_DROME	Rh6	genetic	10594055
OPS2_DROME	Rh2	genetic	21393546
OPS3_DROME	Rh3	genetic	1403087
DRICE_DROME	Ice	genetic	24553922
TRP_DROME	trp	genetic	15014127
NCASE_DROME	CDase	genetic	14769922
HRD1_DROME	sip3	genetic	19805114
LOLA1_DROME	lola	genetic	26662796
LOLA2_DROME	lola	genetic	26662796
LOLA3_DROME	lola	genetic	26662796
LOLA4_DROME	lola	genetic	26662796
LOLA6_DROME	lola	genetic	26662796
LOLA5_DROME	lola	genetic	26662796
JNK_DROME	bsk	genetic	24553922
HSP7C_DROME	Hsc70-3	physical	26456832
INAD_DROME	inaD	physical	9679151

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OPS1_DROME

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Identification of N-glycosylated proteins from the central nervoussystem of Drosophila melanogaster."; Koles K., Lim J.-M., Aoki K., Porterfield M., Tiemeyer M., Wells L.,Panin V.; Glycobiology 17:1388-1403(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-196, AND MASSSPECTROMETRY.	17893096 [Abstract]