OPS6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OPS6_DROME
• UniProt AC: O01668
• Protein Name: Opsin Rh6
• Gene Name: Rh6
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 369
• Subcellular Localization: Membrane; Multi-pass membrane protein.
• Protein Description: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal..
• Protein Sequence: MASLHPPSFAYMRDGRNLSLAESVPAEIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESMHLSPLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGKDDLTSDSRTQATAEISESQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	N-linked_Glycosylation	AYMRDGRNLSLAESV EECCCCCCCCHHHHC	39.24	-
193	N-linked_Glycosylation	NRYVPEGNMTACGTD CCCCCCCCCCCCCCH	23.99	-
208	N-linked_Glycosylation	YFAKDWWNRSYIIVY HHCCCCCCCHHHHHH	20.83	-
317	Other	ICGSVFAKANAVCNP HHHHHHHHHHHHCCH	30.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OPS6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OPS6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OPS6_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of OPS6_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.