OPS2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OPS2_DROME
• UniProt AC: P08099
• Protein Name: Opsin Rh2
• Gene Name: Rh2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 381
• Subcellular Localization: Membrane; Multi-pass membrane protein.
• Protein Description: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal..
• Protein Sequence: MERSHLPETPFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTSEADSKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	N-linked_Glycosylation	FQAQSSGNGSVLDNV CCCCCCCCCCHHHHH	41.33	-
172	Phosphorylation	GTPMTIKTSIMKILF CCCCCHHHHHHHHHH	21.45	22817900
173	Phosphorylation	TPMTIKTSIMKILFI CCCCHHHHHHHHHHH	18.71	22817900
326	Other	IWGATFAKTSAVYNP ECCCCCCCCHHCCCC	38.53	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OPS2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OPS2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OPS2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL4_DROME	RpL4	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.