UniProt ID | RL4_DROME | |
---|---|---|
UniProt AC | P09180 | |
Protein Name | 60S ribosomal protein L4 | |
Gene Name | RpL4 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 401 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGPLVVYDKDEGLRKAFRNIPGIETINVDKLNLLKLAPGGHVGRFVIWTESAFARLNDLFGTWKKPSTLKKGYNLPQPKMANTDLSRLLKSEEIRKVLRDPRKRVFRSVRRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSHFANVATKAAANRAKLLAARKKKVAAKKPAAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLGNARPL ------CCCCCCCCC | 45.01 | 27794539 | |
16 | Acetylation | LVSVYTEKNEPAKDK CEEEEECCCCCCCCC | 59.83 | 21791702 | |
109 | Acetylation | GRMFAPTKTFRRWHR CCCCCCCHHHHHHHH | 44.61 | 21791702 | |
129 | Phosphorylation | QRRYALVSAIAASGV HHHHHHHHHHHHCCC | 18.14 | 22817900 | |
134 | Phosphorylation | LVSAIAASGVPALVQ HHHHHHHCCCCHHHH | 31.16 | 22817900 | |
158 | Phosphorylation | SEFPLVVSDEVQKVQ CCCCEEECHHHHHHH | 22.15 | 22817900 | |
216 | Acetylation | GPLVVYDKDEGLRKA CCEEEEECCHHHHHH | 39.74 | 21791702 | |
297 | Acetylation | TDLSRLLKSEEIRKV CHHHHHHCHHHHHHH | 61.48 | 21791702 | |
330 | Ubiquitination | TNVRQLIKLNPYAEV CCHHHHHHHCHHHHH | 51.29 | 31113955 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL4_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL4_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL4_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATRIP_DROME | mus304 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...