UniProt ID | CDK5_DROME | |
---|---|---|
UniProt AC | P48609 | |
Protein Name | Cyclin-dependent kinase 5 homolog | |
Gene Name | Cdk5 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 294 | |
Subcellular Localization | ||
Protein Description | Probably involved in the control of the cell cycle. Interacts with D1 and D3-type G1 cyclins. Possible regulator of neuronal differentiation and/or development (By similarity).. | |
Protein Sequence | MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQLVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTDSSSSGH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | MEKIGEGTYGTVFKG CCCCCCCCCCEEECC | 17.93 | - | |
15 | Phosphorylation | EKIGEGTYGTVFKGR CCCCCCCCCEEECCC | 22.96 | - | |
26 | Phosphorylation | FKGRNRDTMEIVALK ECCCCCCCEEEEEEE | 17.29 | 22817900 | |
56 | Acetylation | LREICLLKELKHKNI HHHHHHHHHHCCCCE | 48.31 | 21791702 | |
159 | Phosphorylation | GIPVKCYSAEVVTLW CCCEEEEEEEEEEEE | 27.68 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDK5_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDK5_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDK5_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLH_DROME | Chc | physical | 14605208 | |
DLL_DROME | Dll | physical | 15575970 | |
RAD51_DROME | spn-A | physical | 15575970 | |
CCNC_DROME | CycC | physical | 15575970 | |
COG8_DROME | CG6488 | physical | 15575970 | |
DFD_DROME | Dfd | physical | 15575970 | |
CCNE_DROME | CycE | physical | 15575970 | |
NPL4_DROME | Npl4 | physical | 15575970 | |
CRN_DROME | crn | physical | 15575970 | |
ACOX1_DROME | CG5009 | physical | 15575970 | |
ENA_DROME | ena | physical | 15575970 | |
PANG1_DROME | pan | physical | 15575970 | |
PANG2_DROME | pan | physical | 15575970 | |
ECR_DROME | EcR | physical | 15575970 | |
NUBP2_DROME | CG4858 | physical | 15575970 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...