| UniProt ID | CDK5_DROME | |
|---|---|---|
| UniProt AC | P48609 | |
| Protein Name | Cyclin-dependent kinase 5 homolog | |
| Gene Name | Cdk5 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 294 | |
| Subcellular Localization | ||
| Protein Description | Probably involved in the control of the cell cycle. Interacts with D1 and D3-type G1 cyclins. Possible regulator of neuronal differentiation and/or development (By similarity).. | |
| Protein Sequence | MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQLVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTDSSSSGH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | MEKIGEGTYGTVFKG CCCCCCCCCCEEECC | 17.93 | - | |
| 15 | Phosphorylation | EKIGEGTYGTVFKGR CCCCCCCCCEEECCC | 22.96 | - | |
| 26 | Phosphorylation | FKGRNRDTMEIVALK ECCCCCCCEEEEEEE | 17.29 | 22817900 | |
| 56 | Acetylation | LREICLLKELKHKNI HHHHHHHHHHCCCCE | 48.31 | 21791702 | |
| 159 | Phosphorylation | GIPVKCYSAEVVTLW CCCEEEEEEEEEEEE | 27.68 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDK5_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDK5_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDK5_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CLH_DROME | Chc | physical | 14605208 | |
| DLL_DROME | Dll | physical | 15575970 | |
| RAD51_DROME | spn-A | physical | 15575970 | |
| CCNC_DROME | CycC | physical | 15575970 | |
| COG8_DROME | CG6488 | physical | 15575970 | |
| DFD_DROME | Dfd | physical | 15575970 | |
| CCNE_DROME | CycE | physical | 15575970 | |
| NPL4_DROME | Npl4 | physical | 15575970 | |
| CRN_DROME | crn | physical | 15575970 | |
| ACOX1_DROME | CG5009 | physical | 15575970 | |
| ENA_DROME | ena | physical | 15575970 | |
| PANG1_DROME | pan | physical | 15575970 | |
| PANG2_DROME | pan | physical | 15575970 | |
| ECR_DROME | EcR | physical | 15575970 | |
| NUBP2_DROME | CG4858 | physical | 15575970 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
