dbPTM

CRN_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CRN_DROME
UniProt AC	P17886
Protein Name	Protein crooked neck
Gene Name	crn
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	702
Subcellular Localization	Nucleus speckle. Concentrated in nuclear speckles.
Protein Description	May be involved in pre-mRNA splicing process. Involved in neurogenesis..
Protein Sequence	MERPQKMPKVAKVKNKAPAEVQITAEQLLREAKERDLEILPPPPKQKISDPAELADYQQRKRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRAGIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDKLFRGYIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERLLERTQHVKVWMSFAKFEMGLSHGDSGPDAELNVQLARRIYERANEMLRQLGDKESRVLLLEAWRDFERDASDSQEMQKVMDKMPRRIKKRQKIVSDNGVEEGWEEVFDYIFPEDEMARPNLKLLAAAKMWKTQKDNTVDDPPATAIASEPEPAADAAPADTTDSGD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CRN_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CRN_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CRN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CRN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WEK_DROME	wek	physical	14605208
ACOX1_DROME	CG5009	physical	14605208
MIRO_DROME	Miro	physical	14605208
ELOA1_DROME	EloA	physical	14605208
DTBP1_DROME	Dysb	physical	14605208
BX42_DROME	Bx42	physical	14605208
RDX_DROME	rdx	physical	14605208
BX42_DROME	Bx42	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CRN_DROME

Related Literatures of Post-Translational Modification