UniProt ID | CRN_DROME | |
---|---|---|
UniProt AC | P17886 | |
Protein Name | Protein crooked neck | |
Gene Name | crn | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 702 | |
Subcellular Localization | Nucleus speckle. Concentrated in nuclear speckles. | |
Protein Description | May be involved in pre-mRNA splicing process. Involved in neurogenesis.. | |
Protein Sequence | MERPQKMPKVAKVKNKAPAEVQITAEQLLREAKERDLEILPPPPKQKISDPAELADYQQRKRKTFEDNLRKNRMVVSHWIKYAQWEEQQQEIQRARSIWERALDNEHRNVTLWLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKYTYMEEMLENVAGARQVFERWMEWQPEEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKKYGDRAGIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYIYLWINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDKLFRGYIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERLLERTQHVKVWMSFAKFEMGLSHGDSGPDAELNVQLARRIYERANEMLRQLGDKESRVLLLEAWRDFERDASDSQEMQKVMDKMPRRIKKRQKIVSDNGVEEGWEEVFDYIFPEDEMARPNLKLLAAAKMWKTQKDNTVDDPPATAIASEPEPAADAAPADTTDSGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CRN_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRN_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRN_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRN_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WEK_DROME | wek | physical | 14605208 | |
ACOX1_DROME | CG5009 | physical | 14605208 | |
MIRO_DROME | Miro | physical | 14605208 | |
ELOA1_DROME | EloA | physical | 14605208 | |
DTBP1_DROME | Dysb | physical | 14605208 | |
BX42_DROME | Bx42 | physical | 14605208 | |
RDX_DROME | rdx | physical | 14605208 | |
BX42_DROME | Bx42 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...