ARRB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARRB_DROME
• UniProt AC: P19107
• Protein Name: Phosrestin-1
• Gene Name: Arr2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 401
• Protein Description: Probably plays an important role in the photoreceptor transduction..
• Protein Sequence: MVVSVKVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMGVKFSKELILCREQIVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNGKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNAQFSKHVAQLETKEGCPITPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIKLNCGTLGGEMQTDVPFKLLQPAPGTIEKKRSNAMKKMKSIEQHRNVKGYYQDDDDNIVFEDFAKMRMNNVNMAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
89	Phosphorylation	REQIVPMTNPNMEMT EHHEECCCCCCCCCC	41.26	27794539
263	Phosphorylation	TKEGCPITPGANLTK CCCCCCCCCCCCCEE	10.79	27794539
332	Phosphorylation	RIKLNCGTLGGEMQT EEEEECCCCCCEEEC	25.16	27794539
352	Phosphorylation	LLQPAPGTIEKKRSN CCCCCCCCHHHHHHH	25.55	27794539
366	Phosphorylation	NAMKKMKSIEQHRNV HHHHHCHHHHHHHCC	28.05	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
366	S	Phosphorylation	Kinase	CASK	Q24210	GPS
366	S	Phosphorylation	Kinase	CAMK4	-	GPS
366	S	Phosphorylation	Kinase	CAMK	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARRB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARRB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DSH_DROME	dsh	physical	12958364
PIPA_DROME	norpA	genetic	11086989
ARRA_DROME	Arr1	genetic	8316831
ARRA_DROME	Arr1	genetic	16735439
GNAQ_DROME	Galphaq	genetic	11086990
NCASE_DROME	CDase	genetic	12637747
NCASE_DROME	CDase	genetic	18184565
OPS1_DROME	ninaE	physical	10339543
OPS1_DROME	ninaE	physical	11086989
OPS1_DROME	ninaE	physical	15014127

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosrestin I undergoes the earliest light-induced phosphorylation bya calcium/calmodulin-dependent protein kinase in Drosophilaphotoreceptors.";
Matsumoto H., Kurien B.T., Takagi Y., Kahn E.S., Kinumi T., Komori N.,Yamada T., Hayashi F., Isono K., Pak W.L.;
Neuron 12:997-1010(1994).
Cited for: PHOSPHORYLATION AT SER-366.
PubMed: 8185954