| UniProt ID | HMOC_DROME | |
|---|---|---|
| UniProt AC | P22810 | |
| Protein Name | Homeotic protein ocelliless | |
| Gene Name | oc | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 542 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional regulator involved in pattern formation and cell determination in the embryonic CNS and larval imaginal disks. Also later in development to coordinate the expression of regulatory and structural genes required for photoreceptor cell fate in the ocelli. Has a dual role in the terminal differentiation of subtypes of photoreceptors by regulating rhodopsin (rh) expression: essential for establishing the expression of rh genes in the pale subset of ommatidia as well as repressing Rh6 in outer photoreceptors.. | |
| Protein Sequence | MAAGFLKSGDLGPHPHSYGGPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHLSGGYGSSVGGGGGGGGASSGGLNLGVGVGVGVGVGVGVSQDLLRSPYDQLKDAGGDIGAGVHHHHSIYGSAAGSNPRLLQPGGNITPMDSSSSITTPSPPITPMSPQSAAAAAHAAQSAQSAHHSAAHSAAYMSNHDSYNFWHNQYQQYPNNYAQAPSYYSQMEYFSNQNQVNYNMGHSGYTASNFGLSPSPSFTGTVSAQAFSQNSLDYMSPQDKYANMV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of HMOC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMOC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMOC_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMOC_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| METL_DROME | metl | physical | 14605208 | |
| TINC_DROME | tinc | physical | 14605208 | |
| KRH1_DROME | Kr-h1 | genetic | 22547825 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...