dbPTM

HMOC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HMOC_DROME
UniProt AC	P22810
Protein Name	Homeotic protein ocelliless
Gene Name	oc
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	542
Subcellular Localization	Nucleus .
Protein Description	Transcriptional regulator involved in pattern formation and cell determination in the embryonic CNS and larval imaginal disks. Also later in development to coordinate the expression of regulatory and structural genes required for photoreceptor cell fate in the ocelli. Has a dual role in the terminal differentiation of subtypes of photoreceptors by regulating rhodopsin (rh) expression: essential for establishing the expression of rh genes in the pale subset of ommatidia as well as repressing Rh6 in outer photoreceptors..
Protein Sequence	MAAGFLKSGDLGPHPHSYGGPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHLSGGYGSSVGGGGGGGGASSGGLNLGVGVGVGVGVGVGVSQDLLRSPYDQLKDAGGDIGAGVHHHHSIYGSAAGSNPRLLQPGGNITPMDSSSSITTPSPPITPMSPQSAAAAAHAAQSAQSAHHSAAHSAAYMSNHDSYNFWHNQYQQYPNNYAQAPSYYSQMEYFSNQNQVNYNMGHSGYTASNFGLSPSPSFTGTVSAQAFSQNSLDYMSPQDKYANMV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HMOC_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HMOC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HMOC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HMOC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
METL_DROME	metl	physical	14605208
TINC_DROME	tinc	physical	14605208
KRH1_DROME	Kr-h1	genetic	22547825

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HMOC_DROME

Related Literatures of Post-Translational Modification