dbPTM

METL_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	METL_DROME
UniProt AC	Q86BS6
Protein Name	Methyltransferase-like protein
Gene Name	metl
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	325
Subcellular Localization
Protein Description	Probable methyltransferase..
Protein Sequence	MLTTSSSTMLGKYGWQILRRLASKSWEHTRQRKKPSGAGSRVLTDAREVFEFNAWDHVQWDEEQELAAKAAVAKNSTSKMEAEQKERFQTDAPKFWDSFYGIHDNRFFKDRHWLFTEFPELAPLAADSAVLQPRSIFELGCGVGNTILPLLQYSSEPQLKVFGCDFSARAIEILRSQRQFDEKRCEVFVMDATLDHWQVPFEENSQDIIVMIFVLSAIEPKKMQRVLDNCYRYLRPGGLLLFRDYGRYDLAQLRFKSGKCMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDRRLQVNRCRGLKMYRVWIQTKFRKPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of METL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of METL_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of METL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of METL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DYL2_DROME	Cdlc2	physical	14605208
RALA_DROME	Rala	physical	14605208
DYL1_DROME	ctp	physical	14605208
PSN_DROME	Psn	physical	11738826

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of METL_DROME

Related Literatures of Post-Translational Modification