CSK2B_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSK2B_DROME
• UniProt AC: P08182
• Protein Name: Casein kinase II subunit beta
• Gene Name: CkIIbeta
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 235
• Protein Description: Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit..
• Protein Sequence: MSSSEEVSWVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQSDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIPGEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLYGFKIHSLAYQIQLQAAANFKMPLRAQRGQPPKDEEPENNADTVPKRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSSEEVSW ------CCCHHHHHH	42.44	19429919
3	Phosphorylation	-----MSSSEEVSWV -----CCCHHHHHHH	40.23	19429919
4	Phosphorylation	----MSSSEEVSWVT ----CCCHHHHHHHH	30.39	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
2	S	Phosphorylation	Kinase	CSK2B	P08182	PhosphoELM
2	S	Phosphorylation	Kinase	CKIIBETA	-	GPS
3	S	Phosphorylation	Kinase	CSK2B	P08182	PhosphoELM
3	S	Phosphorylation	Kinase	CKIIBETA	-	GPS
4	S	Phosphorylation	Kinase	CSK2B	P08182	PhosphoELM
4	S	Phosphorylation	Kinase	CKIIBETA	-	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSK2B_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSK2B_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WDR12_DROME	CG6724	physical	14605208
SISA_DROME	sisA	physical	14605208
CSK2A_DROME	CkIIalpha	physical	14605208
MLR_DROME	Mlc2	physical	14605208
DTX_DROME	dx	physical	14605208
SAP30_DROME	Sap30	physical	14605208
SIR2_DROME	Sir2	physical	14605208
RSMB_DROME	SmB	physical	14605208
DEI_DROME	tx	physical	14605208
RL18A_DROME	RpL18A	physical	14605208
PHLP_DROME	CG7650	physical	14605208
RS8_DROME	RpS8	physical	14605208
TBB1_DROME	betaTub56D	physical	14605208
PDFR_DROME	Pdfr	genetic	16242403
PER_DROME	per	physical	24013921
CSK2B_DROME	CkIIbeta	physical	11874456
TIM_DROME	tim	physical	24013921
SSL_DROME	Ssl	physical	11874456
CLOCK_DROME	Clk	physical	24013921
CSK2A_DROME	CkIIalpha	physical	19144847
CSK2A_DROME	CkIIalpha	physical	24013921
CSK2A_DROME	CkIIalpha	physical	10329473

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.