UniProt ID | SAP30_DROME | |
---|---|---|
UniProt AC | Q9VXB3 | |
Protein Name | Histone deacetylase complex subunit SAP30 homolog | |
Gene Name | Sap30 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 173 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the class 1 Sin3A-histone deacetylase (Rpd3) complex (HDAC). Appears to be a non-essential subunit of this complex which is not required for cell cycle regulation of progression through the G2 phase of the cell cycle.. | |
Protein Sequence | MNNGFSTGEEDSRGHTDQTCCLIDDMERCRNQAGYASYSKRIQKTVAQKRLKLSSDPAAQHIYICDHHKERIQSVRTKRRRKDSEDDSNETDTDLHEFPDLYQLGVSTLRRYKRHFKVQTRQGMKRAQLADTIMKHFKTIPIKEKEIITFFVYMVKMGSNKLDQKNGLGNDTT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MNNGFSTGEEDSR --CCCCCCCCCCCCC | 36.58 | 19429919 | |
7 | Phosphorylation | -MNNGFSTGEEDSRG -CCCCCCCCCCCCCC | 46.48 | 19429919 | |
84 | Phosphorylation | TKRRRKDSEDDSNET HHHHCCCCCCCCCCC | 46.06 | 19429919 | |
88 | Phosphorylation | RKDSEDDSNETDTDL CCCCCCCCCCCCCCH | 49.22 | 23607784 | |
91 | Phosphorylation | SEDDSNETDTDLHEF CCCCCCCCCCCHHHC | 48.74 | 23607784 | |
93 | Phosphorylation | DDSNETDTDLHEFPD CCCCCCCCCHHHCHH | 48.13 | 23607784 | |
102 | Phosphorylation | LHEFPDLYQLGVSTL HHHCHHHHHHHHHHH | 14.74 | 23607784 | |
108 | Phosphorylation | LYQLGVSTLRRYKRH HHHHHHHHHHHHHHH | 23.13 | 23607784 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAP30_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAP30_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAP30_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-84; SER-88; THR-91 ANDTHR-93, AND MASS SPECTROMETRY. |