dbPTM

SSL_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SSL_DROME
UniProt AC	Q24536
Protein Name	Suppressor-of-stellate-like protein
Gene Name	Ssl
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	219
Subcellular Localization
Protein Description
Protein Sequence	MSCPRSIEIPDGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFDSQTLEVVLDPEFDNEDWDCAEEKKLYGMIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYCPSCNNVYIPLPHNGMLDGAMFGTSFPHMFFMQLPSLIPSPPVEKYIPRIYGFQLHKKALMPPESAESPPIKVESSVSKSPSWLRNVPNF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SSL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SSL_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SSL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SSL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SSL_DROME	Ssl	physical	11874456
CSK2A_DROME	CkIIalpha	physical	11874456

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SSL_DROME

Related Literatures of Post-Translational Modification