RSMB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSMB_DROME
• UniProt AC: Q05856
• Protein Name: Small nuclear ribonucleoprotein-associated protein B
• Gene Name: SmB
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 199
• Subcellular Localization: Nucleus. Nucleus, Cajal body .
• Protein Description: May have a functional role in pre-mRNA splicing or in snRNP structure. Involved in germline establishment and development..
• Protein Sequence: MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKRVLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMPINLSAVPAGLQGPVRGVGGPAQQHMAPMGRGVPRAPMMGAPPPGMIPGGMPSMPGNMGRGAPPPMRGPPPSMIRGAPPPGRGGY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RSMB_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSMB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSMB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSMB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTRM_DROME	mtrm	physical	14605208
COPB_DROME	betaCOP	physical	14605208
ARCH_DROME	CG6353	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.