UniProt ID | PHLP_DROME | |
---|---|---|
UniProt AC | Q9VUR7 | |
Protein Name | Phosducin-like protein | |
Gene Name | CG7650 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 276 | |
Subcellular Localization | ||
Protein Description | Functions as a co-chaperone for CCT in the assembly of heterotrimeric G protein complexes, facilitates the assembly of both Gbeta-Ggamma and RGS-Gbeta5 heterodimers.. | |
Protein Sequence | MATLEDKLLGEKLEYYCSSSEGEDNGDEGGDNKGASGKSRCSGLTIDTNPDATPAGGFRQQSSTNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELDELMSEDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQLAACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTDDLSDDFFASDVESFLIEHGIIVDRALYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | EKLEYYCSSSEGEDN HHEEEECCCCCCCCC | 22.30 | 22817900 | |
19 | Phosphorylation | KLEYYCSSSEGEDNG HEEEECCCCCCCCCC | 28.93 | 22817900 | |
20 | Phosphorylation | LEYYCSSSEGEDNGD EEEECCCCCCCCCCC | 33.07 | 22817900 | |
42 | Phosphorylation | ASGKSRCSGLTIDTN CCCCCCCCCCEECCC | 35.41 | 17372656 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHLP_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHLP_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHLP_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PHLP_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-42, AND MASSSPECTROMETRY. | |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-18; SER-19 AND SER-20,AND MASS SPECTROMETRY. |