UniProt ID | HPF1_DROME | |
---|---|---|
UniProt AC | Q9VNI3 | |
Protein Name | Histone PARylation factor 1-like {ECO:0000305} | |
Gene Name | CG1218 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 449 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPKEDCKYWDKCYQQNPAHLSKYNHPKKQQEHEVDGAEGKKVAPKRSASSQSGEQKKEEQTEPVNKDKSNTSASSTEMVNKDTAKGSYEAETEELHKEAMSNISGKNYMEILEKRIRLSVQKEYDNLCESNEFIRHKFLVEMPPDFYEFWKFVGSLKIDPAKPKDAGLEHLDKVFQLQLVGPFEFLAGKFHGAKLGEPGDYLRHWRFYYDPPEFQTIFVRRGTGIHYGYWRDVPQDKENLLIARNDSAKGCQFQFVAGNAFDAFLYYLEHDFAATPFSCGQLAGTKKAVAKYLSDNSLELAQLDRLQRERNKRVVAKTFHRAGIVVPFDQKTEVGYRPLAVSDSELKKMLAMLERKDVDNGAAKQAVLEKLQPVANAANIAVDESDFGSALELGIDMFCSGHKELHMLASSLLVPAYSMLSRPQFIAIAKAHMEQRSREDNLSIFDVLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | KKVAPKRSASSQSGE CCCCCCCCCCCCCCC | 19429919 | ||
49 | Phosphorylation | VAPKRSASSQSGEQK CCCCCCCCCCCCCCH | 19429919 | ||
50 | Phosphorylation | APKRSASSQSGEQKK CCCCCCCCCCCCCHH | 19429919 | ||
52 | Phosphorylation | KRSASSQSGEQKKEE CCCCCCCCCCCHHHH | 19429919 | ||
72 | Phosphorylation | NKDKSNTSASSTEMV CCCCCCCCCCCCCEE | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPF1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPF1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPF1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LACB2_DROME | CG12375 | physical | 14605208 | |
THIO2_DROME | Trx-2 | physical | 22036573 | |
SLU7_DROME | Slu7 | physical | 22036573 | |
PARP1_HUMAN | PARP1 | physical | 27067600 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...