UniProt ID | SNRPA_DROME | |
---|---|---|
UniProt AC | P43332 | |
Protein Name | U1 small nuclear ribonucleoprotein A | |
Gene Name | snf | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus. | |
Protein Description | Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP (By similarity). Plays a role in regulating sex-lethal splicing.. | |
Protein Sequence | MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
114 | Phosphorylation | PPKPAPGTDEKKDKK CCCCCCCCCCCCCCC | 39.67 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNRPA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNRPA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNRPA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RU2A_DROME | U2A | physical | 22036573 | |
RU17_DROME | snRNP-U1-70K | physical | 22036573 | |
SXL_DROME | Sxl | genetic | 10588726 | |
SXL_DROME | Sxl | genetic | 9362474 | |
SXL_DROME | Sxl | genetic | 12490553 | |
SXL_DROME | Sxl | genetic | 16511567 | |
SXL_DROME | Sxl | genetic | 19171941 | |
SNRPA_DROME | snf | physical | 20221253 | |
RUXG_DROME | SmG | physical | 22036573 | |
RUXG_DROME | SmG | physical | 27185460 | |
PHF5A_DROME | CG9548 | physical | 27185460 | |
RU17_DROME | snRNP-U1-70K | physical | 20221253 | |
RUXE_DROME | SmE | physical | 27185460 | |
RSMB_DROME | SmB | physical | 27185460 | |
RU2A_DROME | U2A | physical | 27185460 | |
RU2A_DROME | U2A | physical | 11557816 | |
SMD3_DROME | SmD3 | physical | 27185460 | |
RUXF_DROME | SmF | physical | 27185460 | |
SXL_DROME | Sxl | physical | 20221253 | |
SF3B6_DROME | CG13298 | physical | 27185460 | |
TRSF_DROME | tra | physical | 20221253 | |
NOI_DROME | noi | physical | 27185460 | |
SMD2_DROME | SmD2 | physical | 22036573 | |
SMD2_DROME | SmD2 | physical | 27185460 | |
RU1C_DROME | snRNP-U1-C | physical | 22036573 | |
SMD1_DROME | SmD1 | physical | 27185460 | |
IF4E_DROME | eIF-4E | physical | 21829374 | |
SF3B5_DROME | CG11985 | physical | 27185460 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...