| UniProt ID | SNRPA_DROME | |
|---|---|---|
| UniProt AC | P43332 | |
| Protein Name | U1 small nuclear ribonucleoprotein A | |
| Gene Name | snf | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 216 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP (By similarity). Plays a role in regulating sex-lethal splicing.. | |
| Protein Sequence | MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 114 | Phosphorylation | PPKPAPGTDEKKDKK CCCCCCCCCCCCCCC | 39.67 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNRPA_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNRPA_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNRPA_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RU2A_DROME | U2A | physical | 22036573 | |
| RU17_DROME | snRNP-U1-70K | physical | 22036573 | |
| SXL_DROME | Sxl | genetic | 10588726 | |
| SXL_DROME | Sxl | genetic | 9362474 | |
| SXL_DROME | Sxl | genetic | 12490553 | |
| SXL_DROME | Sxl | genetic | 16511567 | |
| SXL_DROME | Sxl | genetic | 19171941 | |
| SNRPA_DROME | snf | physical | 20221253 | |
| RUXG_DROME | SmG | physical | 22036573 | |
| RUXG_DROME | SmG | physical | 27185460 | |
| PHF5A_DROME | CG9548 | physical | 27185460 | |
| RU17_DROME | snRNP-U1-70K | physical | 20221253 | |
| RUXE_DROME | SmE | physical | 27185460 | |
| RSMB_DROME | SmB | physical | 27185460 | |
| RU2A_DROME | U2A | physical | 27185460 | |
| RU2A_DROME | U2A | physical | 11557816 | |
| SMD3_DROME | SmD3 | physical | 27185460 | |
| RUXF_DROME | SmF | physical | 27185460 | |
| SXL_DROME | Sxl | physical | 20221253 | |
| SF3B6_DROME | CG13298 | physical | 27185460 | |
| TRSF_DROME | tra | physical | 20221253 | |
| NOI_DROME | noi | physical | 27185460 | |
| SMD2_DROME | SmD2 | physical | 22036573 | |
| SMD2_DROME | SmD2 | physical | 27185460 | |
| RU1C_DROME | snRNP-U1-C | physical | 22036573 | |
| SMD1_DROME | SmD1 | physical | 27185460 | |
| IF4E_DROME | eIF-4E | physical | 21829374 | |
| SF3B5_DROME | CG11985 | physical | 27185460 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
