dbPTM

RUXE_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RUXE_DROME
UniProt AC	Q9VLV5
Protein Name	Probable small nuclear ribonucleoprotein E
Gene Name	SmE
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	94
Subcellular Localization	Nucleus.
Protein Description	Associated with the spliceosome snRNP U1, U2, U4/U6 and U5..
Protein Sequence	MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQNVSPTKD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MSFKGNPKV ------CCCCCCCCC	35.35	27794539
90	Phosphorylation	ITLIQNVSPTKD--- EEEEEECCCCCC---	34.11	30478224

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RUXE_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RUXE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RUXE_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ORB2_DROME	orb2	physical	26638074

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RUXE_DROME

Related Literatures of Post-Translational Modification