dbPTM

RUXG_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RUXG_DROME
UniProt AC	Q9VXE0
Protein Name	Probable small nuclear ribonucleoprotein G
Gene Name	SNRPG {ECO:0000312\|FlyBase:FBgn0261791}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	76
Subcellular Localization	Nucleus.
Protein Description	Associated with the spliceosome snRNP U1, U2, U4/U6 and U5..
Protein Sequence	MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RUXG_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RUXG_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RUXG_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RUXG_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUXE_DROME	SmE	physical	18984161
ICLN_DROME	icln	physical	18984161
SMN_DROME	Smn	physical	18984161
SMD2_DROME	SmD2	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RUXG_DROME

Related Literatures of Post-Translational Modification