SMD2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMD2_DROME
• UniProt AC: Q9VI10
• Protein Name: Probable small nuclear ribonucleoprotein Sm D2
• Gene Name: SmD2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 119
• Subcellular Localization: Nucleus.
• Protein Description: Required for pre-mRNA splicing. Required for snRNP biogenesis (By similarity)..
• Protein Sequence: MALVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	VKPKSELTPEELARQ CCCHHHCCHHHHHHH	25.30	19429919
104	Phosphorylation	KMFLRGDSVILVLRN HHHHCCCEEEEEECC	17.55	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMD2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMD2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMD2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUXF_DROME	SmF	physical	14605208
RSMB_DROME	SmB	physical	26308709
RU2A_DROME	U2A	physical	22036573
RUXF_DROME	SmF	physical	26308709
ICLN_DROME	icln	physical	18984161
NCBP1_DROME	Cbp80	physical	22036573
SMD1_DROME	SmD1	physical	26308709
SMD1_DROME	SmD1	physical	18984161

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.