SMD1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMD1_DROME
• UniProt AC: Q9VU02
• Protein Name: Probable small nuclear ribonucleoprotein Sm D1
• Gene Name: SmD1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 124
• Subcellular Localization: Nucleus.
• Protein Description: Essential for pre-mRNA splicing. Implicated in the formation of stable, biologically active snRNP structures (By similarity)..
• Protein Sequence: MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRGRASGRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	ETLLIDDTPKSKTKK EEEEECCCCCCCCCC	28.94	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMD1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMD1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMD1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ICLN_DROME	icln	physical	18984161
FMR1_DROME	Fmr1	physical	24067655
AGO2_DROME	AGO2	physical	24067655
DDX17_DROME	Rm62	physical	24067655
GAWKY_DROME	gw	physical	26308709
DDX3_DROME	bel	physical	24067655

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.