RUXF_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RUXF_DROME
• UniProt AC: Q24297
• Protein Name: Small nuclear ribonucleoprotein F
• Gene Name: SmF
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 88
• Subcellular Localization: Nucleus.
• Protein Description: Associated with the spliceosome snRNP U1, U2, U4/U6 and U5..
• Protein Sequence: MSAGMPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLYIKGMEDDDEEGEMRD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RUXF_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RUXF_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RUXF_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RUXF_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUXE_DROME	SmE	physical	14605208
RU17_DROME	snRNP-U1-70K	physical	22036573
SNRPA_DROME	snf	physical	22036573
RU2A_DROME	U2A	physical	22036573
RUXG_DROME	SmG	physical	18984161
RUXE_DROME	SmE	physical	18984161
ICLN_DROME	icln	physical	18984161
SMN_DROME	Smn	physical	18984161
SMD2_DROME	SmD2	physical	22036573
RU1C_DROME	snRNP-U1-C	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.