UniProt ID | RUXF_DROME | |
---|---|---|
UniProt AC | Q24297 | |
Protein Name | Small nuclear ribonucleoprotein F | |
Gene Name | SmF | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 88 | |
Subcellular Localization | Nucleus. | |
Protein Description | Associated with the spliceosome snRNP U1, U2, U4/U6 and U5.. | |
Protein Sequence | MSAGMPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLYIKGMEDDDEEGEMRD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RUXF_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RUXF_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RUXF_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RUXF_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUXE_DROME | SmE | physical | 14605208 | |
RU17_DROME | snRNP-U1-70K | physical | 22036573 | |
SNRPA_DROME | snf | physical | 22036573 | |
RU2A_DROME | U2A | physical | 22036573 | |
RUXG_DROME | SmG | physical | 18984161 | |
RUXE_DROME | SmE | physical | 18984161 | |
ICLN_DROME | icln | physical | 18984161 | |
SMN_DROME | Smn | physical | 18984161 | |
SMD2_DROME | SmD2 | physical | 22036573 | |
RU1C_DROME | snRNP-U1-C | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...