RU1C_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RU1C_DROME
• UniProt AC: Q9VE17
• Protein Name: U1 small nuclear ribonucleoprotein C {ECO:0000255|HAMAP-Rule:MF_03153}
• Gene Name: snRNP-U1-C {ECO:0000255|HAMAP-Rule:MF_03153}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 145
• Subcellular Localization: Nucleus .
• Protein Description: Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region (By similarity). Regulates alternative splicing of a distinct group of target genes..
• Protein Sequence: MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMPYMPPLMNPMMGMRPPPIMNPMAMMGPPPPLGTIPGVRPGIMNGPK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RU1C_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RU1C_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RU1C_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RU1C_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.