UniProt ID | SF3B6_DROME | |
---|---|---|
UniProt AC | Q9VRV7 | |
Protein Name | Splicing factor 3B subunit 6 {ECO:0000312|FlyBase:FBgn0035692} | |
Gene Name | Sf3b6 {ECO:0000312|FlyBase:FBgn0035692} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 121 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (Probable). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA (By similarity). Directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing (By similarity). Enters the spliceosome and associates with the pre-mRNA branch site as part of the 17S U2 or, in the case of the minor spliceosome, as part of the 18S U11/U12 snRNP complex, and thus may facilitate the interaction of these snRNP with the branch sites of U2 and U12 respectively (By similarity).. | |
Protein Sequence | MNKRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFKRVDMDKKQEELNNIKAKYNLKTPEAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SF3B6_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SF3B6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SF3B6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SF3B6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SF3B5_DROME | CG11985 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...