UniProt ID | SF3B5_DROME | |
---|---|---|
UniProt AC | Q9VHI4 | |
Protein Name | Splicing factor 3B subunit 5 {ECO:0000312|FlyBase:FBgn0040534} | |
Gene Name | Sf3b5 {ECO:0000312|FlyBase:FBgn0040534} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 85 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing as component of spliceosome. [PubMed: 27185460] | |
Protein Sequence | MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SF3B5_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SF3B5_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SF3B5_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SF3B5_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNRPA_DROME | snf | physical | 27185460 | |
RUXG_DROME | SmG | physical | 27185460 | |
TAF9_DROME | e(y)1 | physical | 27185460 | |
TAFAB_DROME | Taf10b | physical | 27185460 | |
PHF5A_DROME | CG9548 | physical | 27185460 | |
RUXE_DROME | SmE | physical | 27185460 | |
RSMB_DROME | SmB | physical | 27185460 | |
TRA1_DROME | Nipped-A | physical | 27185460 | |
RU2A_DROME | U2A | physical | 27185460 | |
SMD3_DROME | SmD3 | physical | 27185460 | |
RUXF_DROME | SmF | physical | 27185460 | |
SF3B6_DROME | CG13298 | physical | 27185460 | |
NOT_DROME | not | physical | 27185460 | |
SGF11_DROME | Sgf11 | physical | 27185460 | |
NOI_DROME | noi | physical | 27185460 | |
SMD2_DROME | SmD2 | physical | 27185460 | |
TAD2B_DROME | Ada2b | physical | 27185460 | |
TAF12_DROME | Taf12 | physical | 27185460 | |
SMD1_DROME | SmD1 | physical | 27185460 | |
ENY2_DROME | e(y)2 | physical | 27185460 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...