dbPTM

TAFAB_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TAFAB_DROME
UniProt AC	Q9XZT7
Protein Name	Transcription initiation factor TFIID subunit 10b
Gene Name	Taf10b {ECO:0000312\|EMBL:AAF51211.1, ECO:0000312\|FlyBase:FBgn0026324}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	146
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors..
Protein Sequence	MVGSNFGIIYHNSAGGASSHGQSSGGGGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADYGINVRKVDYSQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TAFAB_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TAFAB_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TAFAB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TAFAB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF8_DROME	Taf8	physical	14605208
TAF9_DROME	e(y)1	physical	12482983
TAF10_DROME	Taf10	physical	12482983
TBP_DROME	Tbp	physical	12482983
TAF4_DROME	Taf4	physical	12482983
MED25_DROME	MED25	physical	25242320

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TAFAB_DROME

Related Literatures of Post-Translational Modification