UniProt ID | PHF5A_DROME | |
---|---|---|
UniProt AC | Q9VMC8 | |
Protein Name | PHD finger-like domain-containing protein 5A | |
Gene Name | Phf5a {ECO:0000312|FlyBase:FBgn0031822} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 111 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHF5A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHF5A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHF5A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PHF5A_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...